SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Monodelphis domestica 76_5 > ENSMODP00000011131

Domain assignment for ENSMODP00000011131 from Monodelphis domestica 76_5

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMODP00000011131
Domain Number 1	Region: 492-548
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000000536
Family	TSP-1 type 1 repeat	0.0045
Further Details:

Domain Number 2	Region: 315-372
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000000122
Family	TSP-1 type 1 repeat	0.0053
Further Details:

Domain Number 3	Region: 552-603
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000000235
Family	TSP-1 type 1 repeat	0.0035
Further Details:

Domain Number 4	Region: 373-429
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000000301
Family	TSP-1 type 1 repeat	0.0043
Further Details:

Domain Number 5	Region: 433-486
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.000000445
Family	TSP-1 type 1 repeat	0.0057
Further Details:

Domain Number 6	Region: 262-312
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000275
Family	TSP-1 type 1 repeat	0.0061
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMODP00000011131 Gene: ENSMODG00000008931 Transcript: ENSMODT00000011348
Sequence length	654
Comment	pep:known_by_projection chromosome:BROADO5:1:160187262:160565529:1 gene:ENSMODG00000008931 transcript:ENSMODT00000011348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MFVSYLILTLFYVQTAVLARPEGETIGCDDYLGSDRVVDKCGICGGDNTGCQIVSGVFKH TLTSLGYHRVVEIPQGATKINITEMYKSNNYLALRSRSGRSIINGNWAIDRPGKYEGGGT MFTYKRPNEISSTAGESFLAEGPTNEILDVYMIHQQPNPGVHYEYVISGTNAISPQLPPH RRPGEPFNGQLAVPDGRNPEEEEKQEEKKFPSGEMEIFTEDKVHSFPVRQPERFSPHQPD NLVPVLQSPRRTRDHNWKQVGTTECSATCGKGTLYHINHCERRNTHEEAPESYCDPSTKP TPEEEACNIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQMYANRTLTVQPYRCQHLEK PETTSTCQLKICSEWQIRTEWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLRPND IENCDMGACAKSWFLTEWSERCSAECGVGVRTRSVVCMTNHVSSLPLEGCGNNRPAEITP CDNGPCAGKVEWFAGSWSQCSIECGRGTQQREVICIRKNPDTFDVLDPHECSFSERPPSQ QSCYLKPCGAKWFSTEWSVCSKSCQGGFRVREVRCLSDDMTPSNHCDPQYKPEEKESCNT QDCVPEVDENCKDKYYNCNVVVQARLCVYTYYKTACCASCTRVANRQSTFSGRR
Download sequence
Identical sequences	F7GL34 XP_007479716.1.35504 ENSMODP00000011131 ENSMODP00000011131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]