SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011172 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011172
Domain Number 1 Region: 1464-1541
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000421
Family Canonical RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011172   Gene: ENSMODG00000008960   Transcript: ENSMODT00000011389
Sequence length 1655
Comment pep:known_by_projection chromosome:BROADO5:8:63361411:63422202:-1 gene:ENSMODG00000008960 transcript:ENSMODT00000011389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPREVPPRFRCQQDHKVLLKRGQPPPASCMLLGGGAGPPPSTTPGANPNNAQVTGALLQS
ESGPASDSSIGGAAASNYANSTWGPGASSSNGTAANPTPTWDKVIVDGSDMDEWPCIASK
DTEASSENTTENNSASNPGSEKSPLPGSTTSHKGKGSQGPPGSAGSECNLGVWKSDPKAK
SVPPSISAAENSSGLGTWRNVGGQERVGPASGFSSFNPNSNPSAWPALVQESGSRKGALE
AENSSPSAQGAVVGQVSREQPSKMENAGVNYVVSGREQAPVHNTDGPKSGNTNSLNLSSP
NPAENKGVPFGAGLGSCSRGADAPSQSTGDRQPGNAGSRGSGRGSSGTDTVSGQSNSGNN
GNNGKEREDSWKGASGQKSAGSKNDSWDNNSRSTGGGSWNFGPPDPNENKWGEGNKMASG
VSQGEWKQPTGSDELKIGEWSGPNQPNSSTGAWDNQKGHPLPENQGNSQAPCWGRSSSST
GSEVGGQSTGSNHKAGSSDSHNSGRRSYRPNHPDSQAVLQTLLSRTDLDPRVLSNTGWGQ
TQIKQDTIWDIEEMPRPEGKSDKGTEGWESSTTQTKNSGGWGDGPSQSNQIKSGWGELST
PTEWKDPKNTGGWNDYKNNNSSNWGGARPDEKASSSWNDNNSSKDQGWGGRQPNQGWTSG
KNGWGEEVDQTKNSNWESSGSKPATGWGEGGQNEIGTWGNGGNANLTSKSGWDDCKRSPA
WTNETARQSSSWNKQHQQQPPPQQQPQPPQQQQQQQQQQQEASGSWGAPPQPPPPGNGRP
SNPSWNSGPQPSVPKDEEPSGWEEPSPQSISRKMDIDDGTSAWGDPSSYNYKNVNLWDKN
SQGGQAPREQSLPTPMTSKTSSDSKSMQDGWGESDGPVTGTRHPSWEEDDDGGVWNTAGS
QGSSSSHNSAGWGQGGKKQQMKCSLKGGNSDSWMNPLAKQFSNMGLLSQAEDGPGNKMDL
SVGSLPDKKFDVDKRAMNLGDFNDIMRKDRSGFRPPNSKDMGTTDSGPYFEKGGNHGLFG
NSTAQSRGMHTPVQPLNSSPNLRAQVPPQFISPQVSASVLKQFPNSGLNPGLFNLGPQLS
PQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQHEQQVRCARLARSV
SQPQLSQSASCFCGLLWEEREDLTQGQLDRGLFRLPNETTKGLKNDGDSLGRCFGSSGMD
YGMVGGKEAGTESRFKQWTSMMEGLPSVATQDAGMHKNGAIVPPGKARGGSPYNQFDIIP
GDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSHASWPPEFQPGVPWKGIQNIDPESDPYVT
PGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSAK
FTDYKSTWSPDPIGHNPTHLSNKMWKNHISSRNTSGLPRPPPGLTNPKPSSPWSSTAPRS
VRGWGAQDSRLASASAWSDGGTARPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLNL
TQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDEEVSRFLAQAQPPTPAATPTA
PAAAAAGWQPLETGQSQADPVGPALNLFGGSAGLGQWSSGGGSSSGGDLPGASLWGPPNY
SSSLWGVPSVEDPHRMGSPAPLLPGDLLGGGSDSI
Download sequence
Identical sequences F7G2D9
ENSMODP00000011172 ENSMODP00000011172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]