SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011195 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011195
Domain Number 1 Region: 397-452
Classification Level Classification E-value
Superfamily CCCH zinc finger 2.49e-21
Family CCCH zinc finger 0.000031
Further Details:      
 
Domain Number 2 Region: 369-395
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000837
Family CCCH zinc finger 0.00041
Further Details:      
 
Domain Number 3 Region: 341-366
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000123
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011195   Gene: ENSMODG00000008978   Transcript: ENSMODT00000011412
Sequence length 1230
Comment pep:known_by_projection chromosome:BROADO5:4:385982640:386021806:1 gene:ENSMODG00000008978 transcript:ENSMODT00000011412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYREDGELEEGELEDDGAEETQDISAGQERSRREKGEKHHSDSDDEKAHRRMKRKRKKE
REKEKRRSKKKRKSKHKRHASSSDDFSDFSDDSDFSPSEKSHRKYRDYSPPYSSSHQQYP
SSHNAPLSKKGYSKMESKNYSMYDDYENEQYGEYEGEEEEDLGKEEYDDFTKELNQYRRA
KEGSSRGRGARVRGRGYRGRGGRGGPRGRGMGRGNRGRGRGSMGDHPEEEEDFYEEEMEF
GENEELMGEEEYDEFSKELNQYRRPKDGRGRGLSRGRGRGSRGRGKGMGRGRGRGGSRGG
MNKGGGMNDDEDFYDEDMGDGGGGGSYRRNDHDKPHQQSDKKGKVICKYFVEGRCTWGEH
CNFSHDIELPKKRELCKFYITGFCARAENCPYMHGDFPCKLFHTTGNCINGDDCMFSHDP
LTEETRELLDKMLADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPPRPPVPPAP
TSPNGRPVPGGPPPPPPPPPPPPGPPQMPMPMPSHEPLSPQQLQQQQDMYNKKIPSLFEI
VVRPTGQLAEKLGVRHPAPPPPRFPGPGGPPGPMGPGPNMGPPGPMPGPMHPDMHPDMHP
DMHPDMHPDMHPDMHPDMHPDMHPDMQMGPGMNPGPPMGPGGPPMMPYGPEDSPHSGMMP
PVPPAQNFYENFYQQQEGMEMDPGLMGEAEDYGHYEEMEGEAGEHVFPEQPLEPDGFLEA
GPPGRQQPATSVPDFLPSAQRALYLRIQQKQQEEERARRLAESSKQERENEEGDTGNWYS
SDEDDGGSSVTSILKTLRQQTSSRPQAPVGESSGSSSGSLPGVGDPRLQKGPSAGGRPAD
PRLARDPRLSRHADAAGPSGSGDSGPSDPRLARPVPTSKPDGLHSSPACTSGGKGSGPPE
EEEGERALREKAVTIPLDALPGPPLRDPRLQLQQFSHIKKDVTLNKPSFARTVLWNPEDL
IPLPVPKQDSATSLPPALQSLPALDPRLHRPPAAGPSDPRQRGAAPSDPNPAPTASAANL
PDFELLSRILKTVNASSPSAPSPSDKPSDPRVRKAPADPRLQKPGDAASSRATKPSAPEV
AAPPPASSGEASPPAIAPYDPRVLAAGGVSQGGGSGQSSVLSGISLYDPRTPNSGSKAAE
PAPEGGAQPKGPDGNGKSSAAKAKEPPFIRKSALEQPEAGKAGSEPTATDRSPPPAGDAA
CAERMSGPKRTPWQSGETCRSLHRVVTVNA
Download sequence
Identical sequences F7FRL8
ENSMODP00000011195 ENSMODP00000011195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]