SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011216 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011216
Domain Number 1 Region: 99-197
Classification Level Classification E-value
Superfamily SH2 domain 4.01e-29
Family SH2 domain 0.00001
Further Details:      
 
Domain Number 2 Region: 316-376
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-22
Family SH3-domain 0.0000516
Further Details:      
 
Domain Number 3 Region: 42-115
Classification Level Classification E-value
Superfamily SH3-domain 8.32e-16
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011216   Gene: ENSMODG00000008992   Transcript: ENSMODT00000011433
Sequence length 378
Comment pep:known_by_projection chromosome:BROADO5:8:63733381:63763165:-1 gene:ENSMODG00000008992 transcript:ENSMODT00000011433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQENVFLTRNSPLPTLEFQEQSDGTLYGLVQAPQSPAAGQMPLSRQKGLIAALSLFPQRR
MEAVAKFDFNASGEDELSFHTGDVLKILSSQDEWFKAELGSQEGYVPKNFIDIQFPSWFH
EDISRHDAESLLMGKDVGSFIIRASQSSPGDFSISVRHEDDVQHFKVMRDAKGHYFLWTE
KFQSLNQLVNFYRTSSISKQKQIYLRDGGREEQDRWGGSLERRLQEGLHISGGVGEETRP
STNRKQSDHPPALQSHYQAQQPSPHQQQPIPGKLALGHVSSDRRGGSFDVNEGRRMNPEM
NAALMHRRHTDPEQLQMVGRIRWARALYDFEAEEEDELGFCTGEVVEVLDSSNPSWWTGR
LHSRLGLFPANYVTPLLR
Download sequence
Identical sequences F7BQB2
ENSMODP00000011216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]