SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011230 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011230
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-19
Family HkH motif-containing C2H2 finger 0.051
Further Details:      
 
Domain Number 2 Region: 53-78
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000445
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011230   Gene: ENSMODG00000009007   Transcript: ENSMODT00000011448
Sequence length 168
Comment pep:known_by_projection chromosome:BROADO5:3:518377724:518389943:-1 gene:ENSMODG00000009007 transcript:ENSMODT00000011448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRYFCDYCDRSFQDNLHNRKKHLNGVQHLRAKKVWYDLFRDAAAILVEEQNKRPCRKF
LETGQCDFDSNCRFSHMTSGDLELLAAQVHEERLSREQDVVEVPEGGIEDWLEKRAKQRS
SAQSSSTLSAKPVVFQYPPGWPPIQELPPSLRAPPPGGWPQQPSVQWG
Download sequence
Identical sequences F7BPY5
13616.ENSMODP00000011230 XP_007490582.1.35504 XP_007490583.1.35504 XP_016288026.1.35504 ENSMODP00000011230 ENSMODP00000011230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]