SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011262 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011262
Domain Number 1 Region: 108-201
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.44e-27
Family La domain 0.0011
Further Details:      
 
Domain Number 2 Region: 237-299
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000357
Family Canonical RBD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011262   Gene: ENSMODG00000009034   Transcript: ENSMODT00000011480
Sequence length 514
Comment pep:known_by_projection chromosome:BROADO5:1:159254105:159271335:-1 gene:ENSMODG00000009034 transcript:ENSMODT00000011480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPMEVGGGDGARQEEDAVGEEEQYEVWSRTKSPVQIRVAIQAAEEEEEEEARASMGGV
GEGEDDGDSARYLSPGWGSASEDEPSRGHSTTTSGGENDGSDQDQDWKPPSYELILKLVD
QIEFYFSDENLEKDAFLLKHVRRNKQGYVSVKLLTSFKKVKHLTRDWRTTAYALKYSETL
ELNEDHRKVRRITPVPFFPVENQPSRMLLVYDLHLFPKPWALAVLQENGRLQEKVMEHLL
KVFGTFGVISSVRILKPGKELPPDIRKFSSRYSQVGTQVCAIVEFEEVDAAIRAHESMSM
GSPSKGSIKVVLIGMKAPKKKGSKEKNPEEEPAGSVYQNKTLNKRVEELQYLGDESSANS
SSDPESNPTSPMAERRYVASSKLSPSVYSNHHLSPNASPRSSPWNSPLVQRKGVSKKSPL
AEDATLNSSASPDSVQKCTDYSSDSSITPSSSPWVQRRRLAQWGTHERSPAASPLLTRKV
QNADGSPVGVLRLPRGPDDTRGFHGGYERKRVFV
Download sequence
Identical sequences F7B2J2
ENSMODP00000011262 XP_001377395.2.35504 ENSMODP00000011262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]