SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011308 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011308
Domain Number 1 Region: 520-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000549
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 54-80
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000275
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011308   Gene: ENSMODG00000009065   Transcript: ENSMODT00000011527
Sequence length 907
Comment pep:known_by_projection chromosome:BROADO5:4:298753948:298904496:1 gene:ENSMODG00000009065 transcript:ENSMODT00000011527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISGSGGLPPPQPSPSSSAAASSTSSAAAAVVVAPPGVGGVPSVVGGAAAAAGVKLKYCR
YYAKDKTCFYGEECQFLHEDPVAGAVPGLGLHSNSVPLALAGGGAATPGPAGYPLGAGPG
GGVGPPPGPKKPDMGGPGGGAGGAGGGAAAGGGGGGLDGPRLTIPGIDGGALTDSTLTDS
YFSTSFIGVNGFGSPGENKFPMMQRMTNSSSSPSLLNDSAKPYASHDPLGSPGSSLFNDF
GALSISQRRKPRKYRLGMLEERLVPVGSKARKAKNPIGCLADRCKSGVPINMVWWNRVTE
NNLQTPNPTASEFIPKGGSTSRLSNLSQSNISAFSQALFSHPSVGSPAAAGLAPGMSLSA
GSSPLHSPKITPHTSPAPRRRSHTPNPANYLVPSSASTPLNNPVSQTSSTGQVIQKETVG
GTTYFYTDTTPAPLTGMVFPNYHIYPPTAPHVAYMQPKANAPSFFMADELRQELINRHLI
TMAQIDQADVPAVPAEVDSYHSLFPLEPLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYC
LRRIHGFRLVNTKCMVLVDMWKKIQHSNIVTLREVFTTKAFGEHSLVFAYDFHAGGETMM
SRHFNDPSADAYFTKRKWGQHDGPLPRQHAGLLPESLIWAYVVQLSSALRTIHTAGLACR
VMDPTKILITGKTRLRVNCAGIFDVLTFDNSQNNPLALMAQFQQADLMSLGKVVLALACN
SLAGIQRENLQKAMELVTINYSSDLKNLILYLLTDQNRLRSVNDIMPMIGARFYTQLDAA
QMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFH
QVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELI
AAANGQL
Download sequence
Identical sequences F7FR09
XP_007495321.1.35504 ENSMODP00000011308 ENSMODP00000011308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]