SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011411 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011411
Domain Number 1 Region: 213-481
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-78
Family Protein kinases, catalytic subunit 0.00000000197
Further Details:      
 
Domain Number 2 Region: 103-246
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-38
Family SH2 domain 0.00000993
Further Details:      
 
Domain Number 3 Region: 41-127
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-22
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011411   Gene: ENSMODG00000009142   Transcript: ENSMODT00000011631
Sequence length 491
Comment pep:known_by_projection chromosome:BROADO5:3:184094589:184254331:-1 gene:ENSMODG00000009142 transcript:ENSMODT00000011631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKRKHSSTHDGIDLKTQPVHNVDSDLLPGQRFQSNDSEEEMVIAIYPYEGLHPDD
LSFKKGEKMKVLEEYGEWWKAKSLSTKKEGYIPSNYVAKLNSLETEDWFFKDITRKDAER
QLLLPGNRVGAYLIRESETLKGSFSLSVRDYDPLHGDVIKHYKIRSLDNGGYYISPRITF
PTITDLIKHYQRQPDGLCRRLDKACISTQPQKPWDKDAWEIPRESIKLVKKLGAGQFGEV
WMGYYNGSTKVAVKTLKPGTMSVQSFIEEANLMKTLQHEKLVRLYAVVTKEEPIYIVTEF
MAKGSLLDFLKSGEGTKLLLPKLIDFSAQIAEGMAFLERKNYIHRDLRAANVLVSESLIC
KIADFGLARIIRDDEYKAREGAKFPIKWTAPEAINFGSFSIKSDVWSFGILIYEIITYGK
VPYPGRTNAEVIMALGKGYRMPRMDSCPNELYDIMSMCWKERAEERPTFDYLQSVLEDYY
TATEGQYQQQP
Download sequence
Identical sequences F7B0V9
ENSMODP00000011411 ENSMODP00000011411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]