SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011633 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011633
Domain Number 1 Region: 181-446
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-76
Family Protein kinases, catalytic subunit 0.000000000391
Further Details:      
 
Domain Number 2 Region: 77-213
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-35
Family SH2 domain 0.00000179
Further Details:      
 
Domain Number 3 Region: 13-99
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-17
Family SH3-domain 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011633   Gene: ENSMODG00000009310   Transcript: ENSMODT00000011853
Sequence length 450
Comment pep:known_by_projection chromosome:BROADO5:1:23260230:23270821:1 gene:ENSMODG00000009310 transcript:ENSMODT00000011853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAIQAVWPSGTECIAKYNFHGTAEQDLPFSKGDVLTIVAVTKDPNWYKAKNKVGREGII
PANYVQKREGVKVGTKLSLMPWFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCV
SCEGKVEHYRIIYNSSKLSIDEEVFFENLMQLVEHYTTDADGLCTRLIKPKVMEGTVAAQ
DEFSRSGWALNMKDLKLLQTIGKGEFGDVMLGDYRGNKVAVKCIKNDATAQAFLAEASVM
TQLRHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYLRSRGRSVLGGDCLLKFSLDVCE
AMEYLEANNFVHRDLAARNVLVSEDNIAKVSDFGLTKEASCTQDTGKLPVKWTAPEALRE
KKFSTKSDVWSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPAAVYEVMR
NCWHLDAANRPSFLQLREQLEHIKAHELHL
Download sequence
Identical sequences F7GJZ7
ENSMODP00000011633 XP_001365590.1.35504 ENSMODP00000011633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]