SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011795 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011795
Domain Number 1 Region: 276-365
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-23
Family Canonical RBD 0.00000559
Further Details:      
 
Domain Number 2 Region: 101-196
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.16e-21
Family Canonical RBD 0.00000598
Further Details:      
 
Domain Number 3 Region: 6-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.36e-19
Family Canonical RBD 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011795   Gene: ENSMODG00000009436   Transcript: ENSMODT00000012018
Sequence length 439
Comment pep:novel chromosome:BROADO5:1:343905393:343917009:1 gene:ENSMODG00000009436 transcript:ENSMODT00000012018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSTEGGEGFVVKVRGLPWSCSADEVQRFFSECKIQNGASGIRFIYTREGRPSGEAFVE
LESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPF
GCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRY
IEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGY
GGYDDYNGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSTFQSTTGHCVHMRGLPYRA
TENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKANMQHRYVELF
LNSTAGASGGAYEHRYVELFLNSTAGASGGAYANQSSYGGPASQQLSGGYGGGYGGQSSM
SGYDQVLQENSSDFQSNIA
Download sequence
Identical sequences F7AYT6
ENSMODP00000011795 ENSMODP00000011795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]