SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011801 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011801
Domain Number 1 Region: 37-131
Classification Level Classification E-value
Superfamily SH2 domain 8.62e-27
Family SH2 domain 0.00000287
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000000301
Family SOCS box-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011801   Gene: ENSMODG00000009444   Transcript: ENSMODT00000012024
Sequence length 198
Comment pep:known_by_projection chromosome:BROADO5:8:70179375:70182991:1 gene:ENSMODG00000009444 transcript:ENSMODT00000012024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRSHESTVDGAEGTRSQWGATGTAEEQPSEVTRLATAMRELSQAGWYWGSMTVNEAKE
KLKDAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSRLKQFD
SVVHLIEYYVRTCKDKRPGAETPRNGTVHLYLTKPLYTSTPTLQHLCRLSINKCTAKIWE
LPLPTRLKDYLKEYQYQV
Download sequence
Identical sequences F7FZM7
ENSMODP00000011801 XP_001363646.1.35504 XP_016281201.1.35504 XP_016281202.1.35504 XP_016281203.1.35504 XP_016281204.1.35504 ENSMODP00000011801 13616.ENSMODP00000011801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]