SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011850 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011850
Domain Number 1 Region: 38-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000161
Family Ubiquitin-related 0.0000794
Further Details:      
 
Domain Number 2 Region: 331-374
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000511
Family UBA domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011850   Gene: ENSMODG00000009484   Transcript: ENSMODT00000012073
Sequence length 378
Comment pep:known_by_projection chromosome:BROADO5:1:22848633:22871643:-1 gene:ENSMODG00000009484 transcript:ENSMODT00000012073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSDWHLAVKLADQPLAPKSILRLPETELGEYSLGAYSISFLKQLIAGKLQESVPDPEL
IDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKAEPVDKVAAQREFRVLHTAL
HSSPAYRDAVFKMLGNKESLDQIIVATPGLSNDPIALGVLQDKDLFSVFADPSMLDTLVP
AHPALVNAIILVLHSVAGSTPLPVAESSRNLPSSSYRDMPGEQAAIWEMRSFLELISTRS
TPSSSTSSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGTSP
MSTSVQSGTPITNDLFSQALQHALQASGQPNLQSQWQPQLQQLRDMGIHDDELSLRALQA
TGGDIQAALELIFAGGAP
Download sequence
Identical sequences F7FNA4
13616.ENSMODP00000011850 ENSMODP00000011850 ENSMODP00000011850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]