SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011860 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011860
Domain Number 1 Region: 340-563
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-39
Family DBL homology domain (DH-domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 564-731
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-23
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011860   Gene: ENSMODG00000009492   Transcript: ENSMODT00000012083
Sequence length 752
Comment pep:known_by_projection chromosome:BROADO5:8:69261852:69346244:1 gene:ENSMODG00000009492 transcript:ENSMODT00000012083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQPSPNYALEPNEEARLNVEKEKLHHSGSSLEDSDSESILRAPSKNEIIAPGQDKESSN
TPIEIRGHGGCPNKPQKSPSPEYTSGQGNLFQFDRQAPGRISTSPTLRRLRSSTSQLPSH
QDSLETSNWKNWKGTPGSLSKSLPRSPKTCSKSLSSLNLSSKAVPHLQTTIASFDFTNSK
TSWPCPTNSLMDNDACPGIQANNMAHSNHASLSGKEHPSQSRSLISNQWNQGEESYQSRF
YQHRRSSVVVNLPGLEVFPGDLLVPDGVASYLYHPSLLLNSEPKKLRWPFSKKGGSKDKQ
KQAFDLENCLSTIKIPDYSGYEFHSLKDKTWEEVLQRHQKLPGETPDLRKQQEAVWELFT
SECTYYLDHLLVLKMIFMNTLKYLQSYECLLDVDLWRLFANLEELSQVSLGFVSCFFSTI
KAYINSSGSTSSMDFISVLSKHFRGSLCQSHQVYCLNYTSTIFYLESLRQREDFGIYLKW
CERHNQCKRLHLPELLVTPLHRLTRYPLLLKNIWKRSTDAREKITIYSLKEKVEKAIRDL
EGKVKWLDNFQKFRHLQEIIVWPPLWDRDKRFFIPECLKHIFKEHMAESILSPGNRHLLH
EGKLTLAESTRFLDVYLFLFDDFLLITKTKHSKKKLGGSDLGLVCPSLTPELQAMIKEGG
SCTVLDQPIPLDRLVVKSIDPFHVSVFGLRNAFLLQHENRYQQCIAAFLLQAQTEAAKKT
WMAQITTAASCYMKRYETKKSSCTLPAESSEI
Download sequence
Identical sequences F7F9Z4
XP_007503269.1.35504 XP_007503270.1.35504 ENSMODP00000011860 ENSMODP00000011860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]