SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000011964 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000011964
Domain Number 1 Region: 224-311
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.8e-20
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 2 Region: 162-184
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000353
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000011964   Gene: ENSMODG00000009574   Transcript: ENSMODT00000012188
Sequence length 420
Comment pep:novel chromosome:BROADO5:1:343431456:343454069:1 gene:ENSMODG00000009574 transcript:ENSMODT00000012188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSLGSNTYNRQNWEDADFPILCQTCLGENPYIRMTKEKYGKECKICARPFTVFRWCPG
VRMRFKKTEVCQTCSKLKNVCQTCLLDLEYGLPIQVRDAGLSFKDDMPKSDVNKEYYTQN
VEREISNSDGTRPVGVLGKATATSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECP
YRHEKPTDPDDPLADQNIKDRYYGINDPVADKLLKRASTMPRLDPPDDKTITTLYVGGLG
DTISETDLRNHFYQFGEIRTITVVQRQQCAFIQFATRQAAEMAAEKSFNKLIVNGRRLNV
KWGRSQAARGKEKEKEGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYFNLPPSGPPAV
VNIALPPPPGIAPPPPPGFGPHMFHPMGPPPPFMRAPGPIHYPSQDPQRMGAHAGKHSSP
Download sequence
Identical sequences F7AX36
ENSMODP00000011964 XP_001369324.1.35504 ENSMODP00000011964 13616.ENSMODP00000011964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]