SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012202 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012202
Domain Number 1 Region: 84-183
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-31
Family Canonical RBD 0.0000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012202   Gene: ENSMODG00000009767   Transcript: ENSMODT00000012427
Sequence length 184
Comment pep:novel chromosome:BROADO5:1:152252735:152253302:1 gene:ENSMODG00000009767 transcript:ENSMODT00000012427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESPSAFRRGSGHGSEKSTRRTPAGSHSKEDSQRSRSKSRSRSRSRSSRRHYTRSHSPSGS
HNREFRRRHSHHSPMANRRRHVGNRANPDPNCCLGVFGLSLYTTERDLRELFSKYGPIAD
VSIVYDQQSRLSRGFAFVYFKNVADAKEAKERANGMKLDGRRIRVDFSITKRPHTPTPGI
YMGK
Download sequence
Identical sequences F6TFK9
ENSMODP00000012202 13616.ENSMODP00000012202 ENSMODP00000012202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]