SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012220 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012220
Domain Number 1 Region: 360-692
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 1.57e-35
Family Tricorn protease domain 2 0.025
Further Details:      
 
Domain Number 2 Region: 222-290
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000282
Family Canonical RBD 0.005
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012220
Domain Number - Region: 736-817
Classification Level Classification E-value
Superfamily t-snare proteins 0.0432
Family t-snare proteins 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012220   Gene: ENSMODG00000009778   Transcript: ENSMODT00000012445
Sequence length 836
Comment pep:known_by_projection chromosome:BROADO5:6:72554265:72584097:1 gene:ENSMODG00000009778 transcript:ENSMODT00000012445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDAENVAVPEAAEQRAEPEQQAAEEEPERPAGPGAQEAAAAAAAVLVPEVKGEKGDTTV
SVVKPGSEPEAIVKLLAEEKAVVEPASAEPPPLVSPPPGESQPPPTDKVPEPKAEPPAAK
EEKREEKEKAEEGVGKEEEEKEEEEKGGEKEDENKEAEAEQRRLENSNEEDEISFSDPEG
FVDDISEDELLGDVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKIT
NDYYPEEDGKTKGYIFLEYVSPAHALDAVKNADGYKLDKQHTFRVNLFTDFDKYMTISDE
WDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVSIEERARWTET
YVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYLVTFSPLMDTQ
DDPQAIIIWDILTGQKKRGFHCESSAHWPIFKWSHDGKFFARMTMDTLSIYETPSMGLLD
KKSLKIPGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPSRQEIRVRNLFNVVDCKLH
WQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKESIIAFAWEPNGSKFA
VLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFV
DTSDCTMMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDR
FCQLLWRPRPPTLLSQDQIKQIKKDLKRYSKIFEQKDRLSQSKASKELVERRRTMMEDFR
KYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIPLGNQE
Download sequence
Identical sequences F6SZX9
ENSMODP00000012220 ENSMODP00000012220 XP_007498394.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]