SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012383 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012383
Domain Number 1 Region: 846-956
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000163
Family Canonical RBD 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012383
Domain Number - Region: 803-851
Classification Level Classification E-value
Superfamily Connexin43 0.0418
Family Connexin43 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012383   Gene: ENSMODG00000009891   Transcript: ENSMODT00000012608
Sequence length 1021
Comment pep:known_by_projection chromosome:BROADO5:1:342552079:342610056:1 gene:ENSMODG00000009891 transcript:ENSMODT00000012608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPLLLVQLLLTQCEGTGEEHLYEDFQDLDLSQLDASDLDSASCFSELQWGPETSENGF
SQCGTCGEDSELFQIISGENEALLAALTETLDDIQEEDMGLAAFHTLEDGDVPTPGPTSP
APSPKASPDALDGLQALGSEVDELSLLQKLLLSPSHTTPNVEAQKEGAFRRQGASKSKSQ
RPYLKMESPQDKKSSPPQTQSRSYTELHRHLTSAPCCPRTMSRAPDRGWQQLPPSPPAQS
PRPPIKEESDSGEDCSSPRLAQTSSPASPKPSAESTGTQFACAEDMRAMVELIRYMHTYC
LPQRKLPIQGSATPPQPCNNPFKKAKADCTLQKAASFKNAEGKPPDSLVQRPTAVQPPKA
SWSKFSILRELLAQDLFCDVSKPYRLAMPIYASLSPGTKPSPGPSEESQRPSSEKACEVR
IKASPGTSEPRPSFRPLKLEVKEEINALPVAKEEKEEGQGEVRMCTQSPPLSAGTKMGRK
PESSVYAVRRSKRLNPELGPWLSFVDEAPPEERADPLPSLCLDPETYDAEVEVEVGSPEE
GQSVGDQNQQRATQLPALESPSESGSGEPDEDHSCPPLCSRETPRCFTLALSHNDPSLGK
RNFDQVLTVELCGTAGLTPPTTPPYKPIEEDPFKPDVNHRPNKETAPSTPSLEGPRPVAI
ARGPHKSRKKYPERSELLAHLSRATVQPSQVGQKRPFSRSFGDHDYCQVLKPEGSFQRKV
LRSWEPSAHAEDRSQPRLSRADVQVPSKESASCKPPNKDSKPLRDHEIRASLTKHFGLLD
GTLEEEDFALCKSPEYDTVFEDSSSDSGFLLEEEEEDEDEDLCVHSLPCQHCLHPRPFSK
ASWHHGSRSRSSSGSSCHRSRSPANRRTFRCGNKEHCGEGSPSVRHIEKKREKAIGEGRV
VYIRNLSSTMSSSELKKRFEVFGEIVECQVLKRNKRGEKDGFITYRCSEHAALSLRNGAA
LRKCNEPFFQLSYGGLGQFFWTRCTNFDSNIEEASPASVKNKYEAMDFDSLLKEAQRSLH
R
Download sequence
Identical sequences F6VCD4
ENSMODP00000012383 ENSMODP00000012383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]