SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012617 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012617
Domain Number 1 Region: 4-31
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000027
Family LASP-1 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012617
Domain Number - Region: 32-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.022
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012617   Gene: ENSMODG00000010074   Transcript: ENSMODT00000012846
Sequence length 1762
Comment pep:known_by_projection chromosome:BROADO5:1:97290034:97381064:1 gene:ENSMODG00000010074 transcript:ENSMODT00000012846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVQACSRCGYGVYPAEKINCLDQTWHKACFHCEVCKMMLTVNNFVSHQKKPYCHAHNPK
NNTFTSVYQSPLNINLRKQSEAGSEMKYGEDGEQFKSVFHWDMKAKDGTAIHKMPELVNE
KDYWAAYGEGNSWSPGTLPDPEIVRMVEAQKSLSEYADTYEEQRGKGSFPAMITPAYQRA
KKANELASQVQYKRGHDERVSRFTTVADTPELLHAKAGGQLQSDVRYTEDFEQQRGKGSF
PAMITPAYQIAKKANELASDVRYHQQYHKEMKGKAGHTVAGAEGPWAKEYADQFSQDYSE
EYEEARGKGSFPAMITPAYLNAKKANELASDIKYRQDFNKMKGAAHYHSLPAQDNLVLKR
AQSVNKLVSEVEYKKDLENSKGHSINYCETPQFRNVSKISKFTSDNKYKENYQTQLKGHY
EGVGMDRRTLHAMKVANLASNIAYKSDYKHDNIDYNYPATLTPSYQTTMKLIPLKDVNYR
QSIDKLKYSSVTNTPQIVQAKINAQQLSHVNYRADYEKNKLNYTLPQDVPQLVKARANAE
LFSEVKYKEGWEKTKGRGFEMKLDAMPLLAAKASGELASNIKYKEDYEKTKGRALGTKDS
RLLHSLQVAKMSSEVEYKKGFEESKTHFHLPMDMVNIQHAKKAQALASDLDYRKKLHDYT
VLPEDIKTNWAKKAYKLQSELQYKSDLTWMKGVGWMTDGSLNIEQAKKAGELISEKRYRQ
RADALKFTSVTDSSQMEHAKRSQELQSDVAYKSGNEHYVHQYTISKDEPLFLQARANAQH
LSEKLYKSSWEKQKAKGFELRLDSLSFLSAKAKRDLASDIKYKEDYERSRGKLIGAKGVQ
GDSQMAHSLQVSKLQSDLEYKRRFEDVKTQCHVPMDMIHLVHAQKAQHLATDIGYKTALH
QFTALPTDMKVEWAKKAYGLQSDNQYRADLNWMKGAGWIATGSLNVEQAKKAGELISEKK
YRQHPWALKFTSIKDTPEMVQARISYTQAVDRLYREHGEDIKHHYTQTADLPEVLLAKLN
AMNISETRYKESWSKLRDGGYKLRLDALPFQAAKTSSEIISDYKYKEAFEKMKGQMLGSR
SLEDDISLSHSVHATSVQSDVNYKKGFEHSKTQFHLPLDMVTLVHAKKAQSLASDQDYKQ
LLHQYTSLAEDLRLRCAKKAYQLQSENLYRSDLNFMRGVGCVIPGTLEIEGRKKASELIS
ESKYRQQPQSFRYTAVTDSPGLLHAKFSNQITNERLYKAAGKDTSHQYTTTLGLPEFIRA
KINAANLSEAKYKESWHNLCAQGYKLTMEAIPFQTARASRDIASDCQYRHDFVKERGKLI
GARSILDDHRLQHCLRVGKLQSEQQYKKEAPGEAQYHLPMDMVNLVHARKAQALASEHDY
RMRCHDFTALPEDLKLYWAKKAHALQSESRYKSDLNYMKGLGWLALRSPQIENVKKAGEL
ISEVKYRQKPDSIKFTTVVDSPDLVHAKNSYLHCNDRLYRAGDSESMHRYTFLPDHPDFI
RARLNALHLSDKSYKTSWEQIRAAGYDFRLDAIPFQTARASREIASDFRYKEAFLRDRGL
QIGYRSVSDDPRTKHFLAVGKLQSDNEYKREFLKGRSQFQSRMDQPGFVQAKRSQQLASD
VNYRQPLHQYTCDPEQLHLKHAQRAHQLQSDVKYKSDLNLTRGIGWTPPGSYKVEMARRA
AELANARGLRPQGLCAGPDPSGEEDNNQGNVNPDATEILHVKRKKAHLLVNEQPPCRVYD
KETGHRSSPLLSIPQPPQKGTF
Download sequence
Identical sequences F6XN82
XP_007479045.1.35504 ENSMODP00000012617 ENSMODP00000012617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]