SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012644 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012644
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.75e-18
Family Ubiquitin-related 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012644   Gene: ENSMODG00000010095   Transcript: ENSMODT00000012874
Sequence length 137
Comment pep:known_by_projection chromosome:BROADO5:8:14215366:14217664:1 gene:ENSMODG00000010095 transcript:ENSMODT00000012874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVATMQLFVRAQALHTLQVTGQETVAQIKAHVASLEGIAPEDQVLLLGGSPLEDEAILGQ
CGVEPLATLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRF
VNVVPTFGKKKGPNANS
Download sequence
Identical sequences F6XLM8
ENSMODP00000012644 13616.ENSMODP00000012644 ENSMODP00000012644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]