SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012747 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012747
Domain Number 1 Region: 598-677
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000204
Family Canonical RBD 0.015
Further Details:      
 
Domain Number 2 Region: 981-1054
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000462
Family Canonical RBD 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012747
Domain Number - Region: 278-303
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000235
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012747   Gene: ENSMODG00000010182   Transcript: ENSMODT00000012982
Sequence length 1097
Comment pep:novel chromosome:BROADO5:1:340258953:340335084:1 gene:ENSMODG00000010182 transcript:ENSMODT00000012982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIEDVDALKSWLAKLLEPICDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQKE
TSGFVDKLFESLYTKNYLPPLEPAKPEPKPTVQEKEEVREEIFHESAEEEREVRKKKYPS
PQKTRSESSERRTREKKREDGKWREYDRYYERNELYRDKYDWRRGRSKSRSKSRGLSRSR
SRSRGRSKDRDPNRNVAEHRERSKFKSERNDLDSSYVPASAPPTNSSDQYSCGAQSIPST
VTVIAPAHHSENTTESWSNYYNNHSSSNSFGRNPPPKRRCRDYDERGFCVLGDLCQFDHG
NDPLVVDEVALPSMIPFPPPPPGLPPPPPPGILMPPMPGPGPGPGPGPGPGPGPGPGPGH
NMRLPVPQGHGQPPPSVVLPVPRPPITQSNLINNRDQPGTSAVPNLAPVGARLPPPLPQN
LLYTVSERQPMYSRDHGAAASERLQLGTPPPLLAARLVPPRNLMGSSIGYQTSVSSPTPL
VPDTYEPDGYNPEAPSITSTGRSQYRQFFSRTQTQRPNLIGLTSGDMDANPRAANIVIQT
EPPVPVSINSNITRVVLEPDSRKRAMSGLEGPLTKKPWMGKQGNNNQSKQGFLRKNQYTN
TKLEVRKIPQELNNITKLNEHFSKFGTIVNIQVAFKGDPEAALIQYLTNDEARKAISSTE
AVLNNRFIRVLWHRENNEQSPLPPPTQQLLLQQQQQQQQTSLSHLSQQHHHLQQHLHQQQ
ALVAQSPPSTVHGSIQKMMNKPQAPGLYVLNKVPVKHRLGPASGNQGDAAHLLNQSGGTT
GDDCQTFSPSGHAKMVYSSTNLKTTPKLGSASKSHDVQEVLKKKQEAMKLQQDMRKKRQE
VLEKQIECQKMLISKLEKNKNMKPEERANIMKTLKELGEKISQLKDELKTSSAASTPSKL
KSKTEAQKELLDAELDFHKRLSSGEDTTELRKKLNQLQVEAARLGILPVGRGKTMSSQGR
GRGRGRGARGRGSLNHMVVDHRPKAITVMGFFEEEKDELLQHFSKFGDIEDLQEEESPLS
VVLTYKSRSEAENAANQGSKFKDRRLQISWHKPKVPSISTETEEEEAKEEETEASDLFLH
DDDDEDEDEYESRSWRR
Download sequence
Identical sequences F6SUJ5
ENSMODP00000012747 XP_007473895.1.35504 ENSMODP00000012747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]