SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012751 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012751
Domain Number 1 Region: 138-230
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-24
Family SH3-domain 0.0000306
Further Details:      
 
Domain Number 2 Region: 10-124,164-190
Classification Level Classification E-value
Superfamily SH2 domain 6.6e-23
Family SH2 domain 0.00000812
Further Details:      
 
Domain Number 3 Region: 222-304
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000249
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012751   Gene: ENSMODG00000010187   Transcript: ENSMODT00000012986
Sequence length 307
Comment pep:known_by_projection chromosome:BROADO5:2:516857648:516877774:-1 gene:ENSMODG00000010187 transcript:ENSMODT00000012986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRSAKG
PLMVTQRGPLLPSPPESVILQNLLGLNPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIE
PVPRSRQHSGVILRPEEEYVRALFDFNGNDEEDLPFKKGDILKIRDKPEEQWWNAEDSEG
KRGMIPVPYVEKYRPASASVSALIGGNQDNSHPQPLGGPEPGPYAQPSVNTPLPNLQNGP
IYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKHGHFPFTHVRLLDQQ
NPDEDFS
Download sequence
Identical sequences F6SU50
ENSMODP00000012751 ENSMODP00000012751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]