SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012810 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012810
Domain Number 1 Region: 92-263
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.16e-45
Family DnaQ-like 3'-5' exonuclease 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012810   Gene: ENSMODG00000010228   Transcript: ENSMODT00000013045
Sequence length 612
Comment pep:known_by_projection chromosome:BROADO5:1:274371856:274448813:1 gene:ENSMODG00000010228 transcript:ENSMODT00000013045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPSTFAIMLTTLFGAAVGSLFIWKAYQRWRGIISGVEEEEEEVEVEEDKNKELAPTKL
RPPPLSFLVVPKVSQVERILRESVVIVSEREEWERVESFLWEELEQCPVLGIDCEWVNVK
GKARPVSLLQMASPTGYCILIRLPKLISGEAGFPQTLVDLLEDSRILKVGVGCWEDASKL
LREYDLTVRGCLDLRNLAMRQRRDLLPNGLSLKFLAETILSFPLDKSPLLRSSNWDAEDL
TKEQVAYAARDAQISVALFLHLLEYPLSMNSTQNGDNETTWEKILMKCQDLVDIPFHGKG
NSSNTREENSGKMEGSQKTRNLKSRPGVMSSDDQQGRDPRKQKSKPLGKGYSARKSPLYD
NCFLHAPDGQPLCTCDRRKAQWYIDKGIGELVSEDPFVVKLQFEPSGRPESPKDYYLMIK
DNLCVVCGKRESYIRKNVVPHEYRKHFPIEMKDHNSHDVLLLCTSCHAISNYYNNNLKQH
LAEECEAPIGSEEGLRLLEDPIRRQVRSGARALLNAKSLPASRKEELLQAIKEFFNTDTI
TDQMLQEAANLETRINNENYIPHGLKVVQYYAKGGLRSLMKLESLWRQHFLDSMKPKHLP
EQWKRNQKGAQR
Download sequence
Identical sequences F6WLQ1
ENSMODP00000012810 ENSMODP00000012810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]