SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012937 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012937
Domain Number 1 Region: 185-211,241-600
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.7e-57
Family (Uracil-5-)-methyltransferase 0.0016
Further Details:      
 
Domain Number 2 Region: 62-148
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000309
Family Canonical RBD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012937   Gene: ENSMODG00000010321   Transcript: ENSMODT00000013173
Sequence length 633
Comment pep:known_by_projection chromosome:BROADO5:3:509952827:509960591:1 gene:ENSMODG00000010321 transcript:ENSMODT00000013173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMEKEEDAAAAGVDPLGQPVDVDLPAQPAGGEPLEELQEECGGAEEGTPAMYSYIKDDLF
TSEIYKVEIQNVPRYVGFSDVKKFLAKFGLQPHKTKLFGHRPFAFVTFKSQEERDRAMKV
LHGALWKGRCLSIRLAKPKADPMAKKRKREGEEGGPAEAKRPAPGAAEPSSVEEPIAKQI
ADVVTPLWTLPYEEQLERKQQECEQVLQKLTKEIGNNNRTLLPWLFVQKQKFNKLCCPLE
GVKASPLQTEYRNKCEFLIGVGVGCQDKTVGCRLGKYKGGSCAVAEPFDTVHIPAGTKRV
VRAFQEYIRSTPYSVYSPETYEGHWRQLTVRTSRSGETMAIVYFHPQKLSQEELAGLKAS
LGQHFTAGPGQPSGVTSLYFVEEGQRKSPNREDLPLEHVAGEKYIHEELLGLKFRISPHA
FFQVNTPAAEVLYTTIRDWAQLDGEITVLDVCCGTGTIGLSLAQTVKRVIGIELCQEAVE
DARVNAKMNALDNIEFHCGKAEDLVPSLMSSLASQRLTAIVDPPRAGLHSKVILAIRRAE
HLKKLIYVSCNPRAAMSNFVDLCRAPSNRVKGSPFRPVRAVAVDLFPQTLHCEMLILFER
VEHPNDSSAVVEGPPPQSLAPAAPRAEGTELPH
Download sequence
Identical sequences F6S9Y2
ENSMODP00000012937 ENSMODP00000012937 13616.ENSMODP00000012937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]