SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000012939 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000012939
Domain Number 1 Region: 60-299
Classification Level Classification E-value
Superfamily SET domain 2.4e-80
Family Histone lysine methyltransferases 0.00000984
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000012939
Domain Number - Region: 1-22
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0934
Family Chromo domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000012939   Gene: ENSMODG00000010324   Transcript: ENSMODT00000013175
Sequence length 343
Comment pep:known_by_projection chromosome:BROADO5:X:71886356:71889357:-1 gene:ENSMODG00000010324 transcript:ENSMODT00000013175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTWEPRRNLRCANTLKQFHRDLEGEIIRRTGRRPRTVPPRHLDAALVEFLLQKGRQRKAL
QRWERELNARRSHKGSISVENEVDLNGPPKGFSYINEYKVAEGIAVTQVAIGCECKNCLE
APVNGCCPGVSLNKFAYNIQGQVRLQAGQPIYECNSRCRCSDDCPNRVVQRGISYNLCIF
RTSNGRGWGVRTLEKIRRHSFVMEYVGEIITSEEAERRGQVYDRQGITYLFDLDYVEDVY
TVDAAYYGNVSHFVNHSCNPNLQVYNVFIDNLDERLPRIAFFATRTIWAGEELTFDYNMQ
GCADMESTRMDSNFGLAGLTGSPKKRVRIECKCGTEFCRKYLF
Download sequence
Identical sequences F6S9W3
ENSMODP00000012939 13616.ENSMODP00000012939 ENSMODP00000012939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]