SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013069 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013069
Domain Number 1 Region: 24-124
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000166
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013069   Gene: ENSMODG00000010429   Transcript: ENSMODT00000013307
Sequence length 240
Comment pep:known_by_projection chromosome:BROADO5:X:71851287:71852212:-1 gene:ENSMODG00000010429 transcript:ENSMODT00000013307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHRMAAAEGRLLSSPEEPATSGPPEAAGELGPSGKRVVPGIIYLGHIPPCLRPLHVRNLL
SAHGEIGRVFFQSEERHGRRKKSSGLGGSRGGPSLDYSEGWVEFRDKRVAKLVVASLHNT
PMGTQRRSRFRYDLWNLKYLHRFKWSHLSERLAYERHVRQQRVRAEISQAKRETDFYLQS
VEKSKRFLKKERAASAPEKTWGFAQRPTELEIRKHKEQPAQMHRLAEQAQPNAPLLAKIF
Download sequence
Identical sequences F6ZGV6
13616.ENSMODP00000013069 ENSMODP00000013069 ENSMODP00000013069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]