SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013103 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013103
Domain Number 1 Region: 150-357
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.03e-44
Family G proteins 0.0000425
Further Details:      
 
Domain Number 2 Region: 14-147
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.44e-24
Family Obg GTP-binding protein N-terminal domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013103   Gene: ENSMODG00000010453   Transcript: ENSMODT00000013342
Sequence length 380
Comment pep:known_by_projection chromosome:BROADO5:8:262768955:262808628:1 gene:ENSMODG00000010453 transcript:ENSMODT00000013342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRCSCSFLRKYGNFMDNLRLFTKGGAGGMGYPRLGGEGGKGGDVWIVAKKRVNLKQIKD
KYPQKRFVAGDGANSRISALKGEKGLDCEISAPVGIIVTDERGQIIGELNKEDDKILIAQ
GGLGGNLLSNFLPSKGQKRIIHLDLKLIADIGLVGFPNAGKSSLLSKISHAKPDIADYAF
TTIRPQLGKIMYNDLKQVTDLPGLIEGAHLNKGMGHKFLKHIERTKQLLFVVDITGFQLS
SKTKFRSAFETVILLTKELELYKEDLMMKPSLLAVNKMDLPDAKDKFSELVKQLQNPKDF
SHLFGKDEIPGKNMEFQHIIPISAQTGEGIEELKNCLRISLDEQSNQEKEKFSEKQLLNL
RNSNLLYSDLSSKYANVEIT
Download sequence
Identical sequences F7F7T0
ENSMODP00000013103 ENSMODP00000013103 13616.ENSMODP00000013103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]