SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013202 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013202
Domain Number 1 Region: 70-131
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000545
Family ComEA-like 0.042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013202
Domain Number - Region: 192-289
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0357
Family Mitochondrial resolvase ydc2 catalytic domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013202   Gene: ENSMODG00000010535   Transcript: ENSMODT00000013444
Sequence length 369
Comment pep:novel chromosome:BROADO5:1:574554987:574556185:-1 gene:ENSMODG00000010535 transcript:ENSMODT00000013444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFLSVLRLFLEGKWKHFPVMMCPSLYHSLHMSCCQRKSIAPVKKTDFVSVSSDESLKDT
GKRLEDLYSSEEKSAILQVLNTASVNELGAFTFLRGRKSINIVKHREKHGPFQDLESLME
VPLFQYKSTVKVCDSILHPESKEKKKEKKILENSLGKFVRLGIERKKLKAAKSIVSIVFG
NERIAWAHLDNTVMVLDWRQENNFKLMKETYMPAMYLKMISSVVSKIPEADFYILEKRTF
SLQQTTLFPVTLHFHIVEAMLYSLLNKTFAQDGQHRVLSMNRNVVGKHFDLMLGTMRTSG
MALVQQFLSDFPKQEKPWVSFPLENLVRYRSMMETDGRKIKEELWDSLLQAVAFYELFIA
LGLESEILC
Download sequence
Identical sequences F6ZF29
ENSMODP00000013202 13616.ENSMODP00000013202 ENSMODP00000023970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]