SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013253 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013253
Domain Number 1 Region: 170-248
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.07e-19
Family Canonical RBD 0.00000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013253   Gene: ENSMODG00000010578   Transcript: ENSMODT00000013495
Sequence length 325
Comment pep:known_by_projection chromosome:BROADO5:4:197158675:197210285:1 gene:ENSMODG00000010578 transcript:ENSMODT00000013495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATFAVEPQPPPTGAEPMLLGSPTSPKPGANAQFLPGFLMGDLPAPATPQPRSFSGPSVG
VMEMRSPLLAGGSPPQPVVPSHKDKSGAPPVRSIYDDISSPGLGSTPLSSRRQANISVMQ
SPMVGVMPASPGTGVFSPANIGQPRKTTLSPAQLDPFYTQGESLTSDDHLDDTWVTVFGF
PQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVK
PCIDKSVMESFDRSTVYSPGSAFTPPIKTLGTPVQPSSTPRISTMRPLATAYKASTSDYQ
VVSDRQTPRKDESLVSKAMEYMFGW
Download sequence
Identical sequences F7GI14
XP_001369131.1.35504 ENSMODP00000013253 ENSMODP00000013253 13616.ENSMODP00000013253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]