SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013369 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013369
Domain Number 1 Region: 234-407
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-25
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 518-630
Classification Level Classification E-value
Superfamily Second domain of FERM 6.02e-16
Family Second domain of FERM 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013369
Domain Number - Region: 422-512
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0403
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013369   Gene: ENSMODG00000010670   Transcript: ENSMODT00000013614
Sequence length 736
Comment pep:known_by_projection chromosome:BROADO5:8:264578898:264614257:-1 gene:ENSMODG00000010670 transcript:ENSMODT00000013614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPENIEDAYVAVIRPKNTASLNSREYRAKSYEILLLEVPIEGQKKKRKKVLLETKLQG
SGEITQSILDYVVETTKPISPANQGIKGKRVVLMKKFPLDGEKMGREASLFIVPSVVKDN
TKYSYSPGCPVFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRP
SPLERIKTNVINPAYATEPSQTENLLHMGYSALEIKSKMLALEKADTCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKEHQWVDDFPLHRSACEGD
SELLNRLLNDSFSVNQLDNDHWAPIHYACWYGKVEATRMLLEKGKCNPNLLNGQLSSPLH
FAAGGGHVEIVQILLNHPEVDRHIIDQQGRSPLNVCEENKQNDWEETAKLLKEAINKPYE
KVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSHETQQYFTIWICSENLSLQLKPYHKP
LQHVRDWPEILNELTNLDPQRETPQLFLRRDVRLPLEVERKIEDPLAILILFDEARYNLL
KGFYTSPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQVFTKASSSSHKVIRVYV
GVNIKGLHLLNMETKTLLISLKYGCFMWQLGDADSCFQIHSLENKMSFIVHTKQAGLVVK
LLLKLNGQLMPSERNE
Download sequence
Identical sequences F7CJW0
ENSMODP00000013369 XP_001378239.1.35504 XP_007505068.1.35504 XP_007505069.1.35504 XP_016281892.1.35504 ENSMODP00000013369 13616.ENSMODP00000013369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]