SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013444 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013444
Domain Number 1 Region: 69-144
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000078
Family Splicing factor U2AF subunits 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013444   Gene: ENSMODG00000010730   Transcript: ENSMODT00000013690
Sequence length 390
Comment pep:known_by_projection chromosome:BROADO5:8:264923749:264940024:1 gene:ENSMODG00000010730 transcript:ENSMODT00000013690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMASRRKPVSESRGTKSGRMADGGGELGGYHPHHVQRAVCDSRAKYREGRRPRAVKVY
TINLESQYLLIQGVPAVGVMKELIEQFALFGAIEQYNALDEYPAEEFTEVYLIKFQKLQS
ARIAKRKLDERSFFGGLLHVCYAPEFETVQETREKLQERRRYIARTTGIKEDKLQPVTKK
NVYTEPTFTKDLRNYFQSKASEFCATSLNPYTENPWNCHPGSLNSTPYHVSSKYTASESG
DLLERTLIPPQLDRNYNKTMSDYNQKNSLTEMEMIGTSVGYIEPQKVIPSNNGIARFMPR
TTQLQERKRRREEDRKLGTFLETNPRSKEVIIGPQLPEIPKVDMEDESLNMSANLIRNKL
KEVISSQPKPSESKLEDTHISRPLKQRRRI
Download sequence
Identical sequences F7G7G9
XP_007505090.1.35504 ENSMODP00000013444 ENSMODP00000013444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]