SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013458 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013458
Domain Number 1 Region: 217-508
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.06e-68
Family Tandem AAA-ATPase domain 0.00027
Further Details:      
 
Domain Number 2 Region: 581-660
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.2e-21
Family GUCT domain 0.0000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013458   Gene: ENSMODG00000010741   Transcript: ENSMODT00000013704
Sequence length 745
Comment pep:known_by_projection chromosome:BROADO5:Un:17956125:17982549:-1 gene:ENSMODG00000010741 transcript:ENSMODT00000013704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSKVLWGDLMEEEAPLDGPESPRRESGRHKQSDKRKLNHRDDFKKKLETSNNEDLDELS
PPKSKKSKKKEKLNGDTKEGLDRFSSEFSGSPRPEKGKRKDLSTAEENGKTSKSRSSLSN
SSNSKTTKYSKLEEDLTPEQKEGAFSRFPISEETIKLLKARGVTYLFPIQVKAFSPVYEG
KDLIAQARTGTGKTFSFAIPLIEKLQRDQEELKKTRSPKVLVLAPTRELANQVAKDFQDI
TRKLSVACFYGGTPYQGQINHIRRGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQ
MLDMGFADQVEDIIHGSYKTGSEDNPQTLLFSATCPQWVYKVAKKYMKTKYEEIDLVGKM
TQKTATTVEHLAIQCHWSQRAAVIGDVIQVYSGNDGRAIIFCETKKNVAEMALNPHIKQN
AQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIH
RSGRTGRAGRTGICICFYQPNERGQLKYVEGKAGITFKRVGVPTTMDLVKSRSMDAIRSL
ASVSFVAVEFFRPSAQRLIEEKGAVDALAAALAHISGASSFEPRSLINSDKGFVTMTLQS
PEELQDISTARKELSRKLSSDTMSRIVRMCLLKGKMGVCFDIPTSESELMQAEWNDSDWI
LSVPDALPELEEYYDGRRSSNTRQRGGRSGGRFGGGRSGGRSGGRQGGRSGGRQGGGRSR
SRQDNRRRGGGNRSRSRGKKRSSDS
Download sequence
Identical sequences H9H6E9
XP_007505938.1.35504 ENSMODP00000013458 ENSMODP00000013458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]