SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013541 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013541
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-26
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 2 Region: 83-185
Classification Level Classification E-value
Superfamily Second domain of FERM 1.13e-24
Family Second domain of FERM 0.00091
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.58e-20
Family First domain of FERM 0.0019
Further Details:      
 
Domain Number 4 Region: 381-430
Classification Level Classification E-value
Superfamily RING/U-box 0.00000447
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013541   Gene: ENSMODG00000010806   Transcript: ENSMODT00000013790
Sequence length 445
Comment pep:known_by_projection chromosome:BROADO5:3:324263009:324285776:-1 gene:ENSMODG00000010806 transcript:ENSMODT00000013790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDAVLMEVEVEAKANGEDCLYQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEDLLAGNLQCSPEHAVELS
ALLAQTKFGDYNQNTAKYNYEELCAKELTGAALNSITMKHKELEGMSQASAEYQVLKIVS
AMENYGVEWHSVRDSEGQKLLIGVGPEGISICKDDLSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRSDQSPPNSPLKSSESSMNC
GSCEGLNCQQTKALQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCEGCAAQLQSCPV
CRSRIEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences F7BZQ9
ENSMODP00000013541 13616.ENSMODP00000013541 ENSMODP00000013541 XP_001367101.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]