SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013581 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013581
Domain Number 1 Region: 403-488
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 5.1e-25
Family Surp module (SWAP domain) 0.001
Further Details:      
 
Domain Number 2 Region: 252-358
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.15e-21
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 3 Region: 540-677
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.0000000732
Family RPR domain (SMART 00582 ) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013581   Gene: ENSMODG00000010847   Transcript: ENSMODT00000013830
Sequence length 1000
Comment pep:novel chromosome:BROADO5:8:266224475:266227558:1 gene:ENSMODG00000010847 transcript:ENSMODT00000013830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKTEGSSQKSSSKTRSSDTVHSSGSSDTHMYAAGPSDTDMPSQTRPKSPRKNNYRTES
THESLCDSPHQNLSRPLLENKLKEFSIGKMSAAKRTLSKKEQEELKKEEDEKAAAEIYEE
FLAAFESSDGNKVKAFVKGGVVVNAAKEEHKTDEKRGKMYEPSSRCADQKNAPNQSSIER
PPSLLVIETKKPPLKKKEKEKKKSNLELFKEELKQIQEERDERHTTKGRLSCFEPPQSHS
DGQHHSMDAPSQRNISSVPDDYAPGSHDVGDPSTTNLYLGNINPQVNEEMLCQEFGRFGP
LASVKIMWPRTDQERGRKRNCGFVAFMNRIDAERALKNLHGKMIMSFEMKLGWGKAVPIP
LHPIYIPPSMMEHVLPPPPSGLPFNAQPRERLKNPNAPMLPPPKNKEDFEKTLSQAIIKV
VIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENHTPAHVYYRWKLYS
ILQGDAPTKWRTENFCMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEEQR
DKLEEILRGLTPQKKDIGDAMVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVS
DVLYNSSAKVANASYYRKFFEKKLCQIFSDLNATYRTIEGHLQSEKFKQRVMTCFRAWED
WEIYPETFLVRLQNIFLGLENIIEEKETEEVPDDLDGTPIEEELDGVPLEDVDGIPIDAT
PIDDLDGVPIKSLDDDLDGVPLDTSEDSKKNEPILKVTPSKWEAVYESELEVQGVTTSKW
DSKSVEHHLYSNPIKEEMTESKSSIKYSETSEEKRAKLREIELKVMKFQDELESGKRLKK
PGQSFQEQVEHYRDKLIQREKEKELERECERDKKDKEKLESRSKDKKEKDKCTPTRKERK
NRHSTSPNPSRSSSGRRAKSPSPRSERSERSHKESSHSRSSHKDSHRDVSKKAKRSPSGS
RTPKRSSQSRSRSPKKSGKKSRCQSRSPHRSHKKSKKSKH
Download sequence
Identical sequences F7ARL4
ENSMODP00000013581 13616.ENSMODP00000013581 ENSMODP00000013581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]