SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013583 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013583
Domain Number 1 Region: 360-445
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 4.84e-25
Family Surp module (SWAP domain) 0.001
Further Details:      
 
Domain Number 2 Region: 209-315
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.01e-21
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 3 Region: 497-634
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.000000068
Family RPR domain (SMART 00582 ) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013583   Gene: ENSMODG00000010847   Transcript: ENSMODT00000013832
Sequence length 957
Comment pep:novel chromosome:BROADO5:8:266224475:266227558:1 gene:ENSMODG00000010847 transcript:ENSMODT00000013832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADKTEGSSQKSSSKTRSSDTVHSSGSSDTHMPLLENKLKEFSIGKMSAAKRTLSKKEQE
ELKKEEDEKAAAEIYEEFLAAFESSDGNKVKAFVKGGVVVNAAKEEHKTDEKRGKMYEPS
SRCADQKNAPNQSSIERPPSLLVIETKKPPLKKKEKEKKKSNLELFKEELKQIQEERDER
HTTKGRLSCFEPPQSHSDGQHHSMDAPSQRNISSVPDDYAPGSHDVGDPSTTNLYLGNIN
PQVNEEMLCQEFGRFGPLASVKIMWPRTDQERGRKRNCGFVAFMNRIDAERALKNLHGKM
IMSFEMKLGWGKAVPIPLHPIYIPPSMMEHVLPPPPSGLPFNAQPRERLKNPNAPMLPPP
KNKEDFEKTLSQAIIKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFL
FENHTPAHVYYRWKLYSILQGDAPTKWRTENFCMFKNGSFWRPPPLNPYLHGMSEEQETE
AFVEEPSKKGALKEEQRDKLEEILRGLTPQKKDIGDAMVFCLNNAEAAEEIVDCITESLS
ILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFEKKLCQIFSDLNATYRTIEGHLQ
SEKFKQRVMTCFRAWEDWEIYPETFLVRLQNIFLGLENIIEEKETEEVPDDLDGTPIEEE
LDGVPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDTSEDSKKNEPILKVTPSKWE
AVYESELEVQGVTTSKWDSKSVEHHLYSNPIKEEMTESKSSIKYSETSEEKRAKLREIEL
KVMKFQDELESGKRLKKPGQSFQEQVEHYRDKLIQREKEKELERECERDKKDKEKLESRS
KDKKEKDKCTPTRKERKNRHSTSPNPSRSSSGRRAKSPSPRSERSERSHKESSHSRSSHK
DSHRDVSKKAKRSPSGSRTPKRSSQSRSRSPKKSGKKSRCQSRSPHRSHKKSKKSKH
Download sequence
Identical sequences F7ARK2
ENSMODP00000013583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]