SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013593 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013593
Domain Number 1 Region: 325-460
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-35
Family Protein kinases, catalytic subunit 0.00000203
Further Details:      
 
Domain Number 2 Region: 36-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-21
Family Ras-binding domain, RBD 0.0000473
Further Details:      
 
Domain Number 3 Region: 104-161
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000269
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013593   Gene: ENSMODG00000010855   Transcript: ENSMODT00000013842
Sequence length 496
Comment pep:known_by_projection chromosome:BROADO5:X:71694838:71697606:1 gene:ENSMODG00000010855 transcript:ENSMODT00000013842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGPAATPVEAFSRGLAPPGDPSATPSTSARVGGTVKVYLPNQQRTVVTARDGMTVSDS
LDKALKVRGLNQDCCAVYRLVQGRKTATAWDAAIAPLHGEELTVEVRADVPLAAAHNFAR
KTFLALTFCDFCRRFLFHGFRCQTCGYKFHQHCSARVPTICVDMATARQPFYRSIQDLAG
GPRAHEVQPDNQALCEPLTPKSPRYTRQTSHGGEAFAFPGPGGPALQRIRSTSTPNVHMI
STTMPVDSRLIQFSSSGPAGAFLSGFLSVGTGGERIPQSSPGLVSPPGKKSPHPKASAEP
TERKAPALADDKKKVKSLGYRDSGYYWEVAPGEVQLLKRIGTGSFGTVFHGRWHGDVAVK
VLKVAQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPDFAIITQWCEGSSLYHHLHV
ADTHFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNSIHLACVCVWGGGGGKVFQCLKG
PWKGRQNLSCPRDEGE
Download sequence
Identical sequences F7AR37
ENSMODP00000013593 ENSMODP00000013593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]