SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013604 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013604
Domain Number 1 Region: 224-308
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000149
Family Canonical RBD 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013604
Domain Number - Region: 162-185
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0942
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013604   Gene: ENSMODG00000010865   Transcript: ENSMODT00000013853
Sequence length 411
Comment pep:novel chromosome:BROADO5:8:266275570:266294826:1 gene:ENSMODG00000010865 transcript:ENSMODT00000013853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRSLGSSTYSRQNWEHDFPILCQTCLGPNPYTSMTKERCGKECRVCARPFTTFCWYPGI
HMHFKKTQLCQACSKLKNPCQFCLLDPEYGLAHADPCCKIGFSGCHTQDAISKSEVNKGY
YLQNLEGEISNSNGTQSVVAFGKAPVINDMLPQLVQTSPHYKQKPPFCSFWRTRECKEGE
RCPYREKPQDPKDPFAPQNIRDCQLNPPDPMAEKLLKWASTMLHLDPPADETITTLYIGG
LQDTSDTYLRNHWEQFGEILKVIIGQQQQWTFIQFARQAAEMTAEKSFNKLVVKGRKLPV
KWARSQIARGKGKEKEGTTDSGKLELVPGLPGVLPSPLVEASYFHLPSTLSPAGVHVALP
PPQIAPPIPLDFRSHIFLPMGPSPPFMPAPGPCPPTSLQRMGTHTGKLKNP
Download sequence
Identical sequences F7FW83
ENSMODP00000013604 13616.ENSMODP00000013604 ENSMODP00000013604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]