SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013647 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013647
Domain Number 1 Region: 11-121
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.22e-27
Family Canonical RBD 0.00000675
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000013647
Domain Number - Region: 196-229
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0146
Family Aminomethyltransferase beta-barrel domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013647   Gene: ENSMODG00000010899   Transcript: ENSMODT00000013896
Sequence length 260
Comment pep:known_by_projection chromosome:BROADO5:3:322763792:322783380:-1 gene:ENSMODG00000010899 transcript:ENSMODT00000013896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVQNLCPPMAFKKPAPSPCPKRSGKMHTTQKDTTYTKIFVGGLPYHTTDSSLRKYFEVFG
EIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRIM
QPGFAFGVQQLHPALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTAAAASTTPYIDYTGA
AYAQYSAAAAAAAAAAYDQYPYAASPAAAGYVTAGGYGYAVQQPITAAAPGTAAAAAAAA
AAAAAFGQYQPQQLQTDRMQ
Download sequence
Identical sequences F7FJ35
ENSMODP00000013647 ENSMODP00000013647 13616.ENSMODP00000013647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]