SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013677 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013677
Domain Number 1 Region: 241-392,628-714
Classification Level Classification E-value
Superfamily SET domain 2.22e-70
Family Histone lysine methyltransferases 0.0017
Further Details:      
 
Domain Number 2 Region: 151-222
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000317
Family Methyl-CpG-binding domain, MBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013677   Gene: ENSMODG00000010929   Transcript: ENSMODT00000013927
Sequence length 717
Comment pep:known_by_projection chromosome:BROADO5:4:318900081:318953452:-1 gene:ENSMODG00000010929 transcript:ENSMODT00000013927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERNGDAKAFWRELEEDGKLDLIFEHVQNVLLSLKQKIKDGSATNQEYIQAMTLVNEAV
TSNTLLLIKDDDITDRDSEQESKSSILPPTSQEDSNSEDSLILTVEDIAVLTLENEVSNY
EEKILALSLPYQSHDCCDTCLPKIPLTSKVENPLMIPILCRFQRRHAKTNSNYATFHVNY
KTPCGRSLRNFKEVHRYLLETESSFLFLHNFSFNTYVQLNRNTPKKEVFVSDSDISHGTE
SVPITFCNEIDNRRLPHFKYRRRTWPRAYYLNNFSGMFSNSCDCSKGCMDITKCACLQLT
AKGYDESSAYDQNVKPTHGYSYKRLQQPVPNGIFECSLLCKCDPRTCQNRVVQQGLQVRL
QVFKTEKKGWGVRCIDDIDKGTFVCTYSGRLLSRVGLEEIGSVDGKEEEEEEDAATNDNG
PPALSKKRRTEAAYSDPEIEFVQVEVGAIPGDSETQEYLIQLSSDANPSIQGEKYEYDLR
TENQPATRRPKTKTALLQNYRKKRGIVTLESGISSDEEDEVQSPEVQTTPNIREEKMESS
CSGENSKEKLLTTSTGLDNHHCKAERLVENIGDPLASMFDMSGIKECKDRDQVSHEERTR
ERQNQEIFCDEESLSEVQIGVSESIKKFCEDGIYLLDATKEGNVGRFLNHSCNPNLFVQN
VFVETHDRNFPWVAFFTKRHVKAGTELTWDYGYEAGSIPEKEIPCQCGFHTCRKRIL
Download sequence
Identical sequences F7F4Z3
ENSMODP00000013677 ENSMODP00000013677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]