SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013678 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013678
Domain Number 1 Region: 4-177
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.76e-30
Family Canonical RBD 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013678   Gene: ENSMODG00000010927   Transcript: ENSMODT00000013928
Sequence length 287
Comment pep:known_by_projection chromosome:BROADO5:4:367734633:367750466:1 gene:ENSMODG00000010927 transcript:ENSMODT00000013928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLWMGDLEPYMDENFISRAFATMGETVLSVKIIRNRLTGIPAGYCFVEFADLATAEK
CLHKINGKPLPGATPAKRFKLNYATYGKQPDNSPEYSLFVRDLSPDVDDGMLYEFFVKVY
PSCRGGKVVLDQAGISKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKANRV
KPMEYSQMYSYSLNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTMQTYEEVGDDA
LEDPTPQLDVNEANKEFMEQSEELYDALMNCHWQPLDTVSSEIPPVM
Download sequence
Identical sequences F7F4Y9
13616.ENSMODP00000013678 XP_001365071.1.35504 ENSMODP00000013678 ENSMODP00000013678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]