SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013897 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013897
Domain Number 1 Region: 63-262
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.35e-26
Family The homologous-pairing domain of Rad52 recombinase 0.035
Further Details:      
 
Domain Number 2 Region: 12-95
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000179
Family Canonical RBD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013897   Gene: ENSMODG00000011101   Transcript: ENSMODT00000014150
Sequence length 274
Comment pep:known_by_projection chromosome:BROADO5:2:206047276:206060875:-1 gene:ENSMODG00000011101 transcript:ENSMODT00000014150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELLSFTIPAGSEKTLFVWELNPGPGPESLKHSLFTVFSQFGLLYSVRVFPNAPGATPG
FYAIIKFYSARDACSAQKACDQKQLFQNSPVKVRLCTRRKMHQYPIHPLNSFKCQELANY
YLGFNGWSKRIITLQKLSDFKVKENTSPIKSSARQSLKYFCALEVVLPAYSCRSPVCGVK
KSPVDMTEVKPSNFILKRKKTQKLAIQKALSDAFQKLLMVVLESGKVVVEYRSTEERDSA
TDEFKDLIQVNDVSRNQAYQGEEECLSDFGLEEE
Download sequence
Identical sequences F7DL24
ENSMODP00000013897 ENSMODP00000013897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]