SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014003 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014003
Domain Number 1 Region: 184-488
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.44e-84
Family DnaQ-like 3'-5' exonuclease 0.000000418
Further Details:      
 
Domain Number 2 Region: 487-583
Classification Level Classification E-value
Superfamily HRDC-like 2.62e-26
Family EXOSC10 HRDC domain-like 0.00000609
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014003   Gene: ENSMODG00000011194   Transcript: ENSMODT00000014261
Sequence length 888
Comment pep:known_by_projection chromosome:BROADO5:4:366318243:366358823:1 gene:ENSMODG00000011194 transcript:ENSMODT00000014261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSVKGARPGPEAAATPAAAEPSGMMVLPGFKDADSFVKFALGSVLAATKASNGLPQA
GDEYDFYRSFPGFRAFCETQGDRLLQCMSKVMQYHGCRSHIKDRSKVTELEDKFDLLVDS
NDVILERVGILLDEASGLNKNQQPILPAGMQVPQTIVSSWNRKAGEYNKKKQSETFRLLH
AKNIIRPQLKFREKVDNSNTPFVPKIFIKPNAQKPLAQALTKERRERQERPEDLDVPPAL
ADFLYQQRTQQIEQDMFAHPYQYELDHFAIPDEVLQKPQIQMYKPVGETPCHFVTTLDAL
VELNEKLLNCKDFGVDLEHHSYRSFLGLTCLMQISTRTEDFIIDTLELRSDLYILNESFT
DPSIVKVFHGADMDIEWLQKDFGLYVVNMFDTHQAARILNLGRHSLDHLLKLYCNVESNK
QYQLADWRIRPLPEEMFNYARHDTHYLLYIYDKMRSDLWDRANGQPAQLQVVWQRSKDIC
LKRFIKPIFMEDSYLELYRKQKKHLNTQQLTAFQLLYSWRDRTARREDESYGYVLPNHMM
LKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVASGVKKNRPQS
APERIENALFGPHDYSRAPPDDYLNVTATGPAPLQKRATLFSDKNENETMSDVGCLIATA
VITLFSEPSAGEENEGRLTAAQKKAQSIMESFENPFRMYLPSEENHAYVSQSAKFDPMSK
IYEISNRWKLASQVQIKKEAQEALRKKAEQTAAREQAKEEYKAATQQVISVRQQAVLENA
TKKRERMGSEPETPEPKQEKKRLKASQPPQEQEPPKEFTPYDYSKSDFKAFSGNSKAKQS
AQFDPNKQDPPGKKCATVGKPKQPAGNRSKSFVTGKSERGFRYSWPKR
Download sequence
Identical sequences F6T6Q0
XP_001364197.2.35504 ENSMODP00000014003 13616.ENSMODP00000014003 ENSMODP00000014003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]