SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014104 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014104
Domain Number 1 Region: 401-693,798-840
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.07e-72
Family FAD-linked reductases, N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 674-788
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.26e-24
Family L-aminoacid/polyamine oxidase 0.0008
Further Details:      
 
Domain Number 3 Region: 291-396
Classification Level Classification E-value
Superfamily Homeodomain-like 2.96e-19
Family SWIRM domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014104
Domain Number - Region: 82-126
Classification Level Classification E-value
Superfamily RING/U-box 0.0636
Family RING finger domain, C3HC4 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014104   Gene: ENSMODG00000011270   Transcript: ENSMODT00000014363
Sequence length 841
Comment pep:known_by_projection chromosome:BROADO5:3:321812859:321860377:-1 gene:ENSMODG00000011270 transcript:ENSMODT00000014363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLLTATRRTSSVQRLCDKMSTLRVRAKKKAASFDQPSDSLPLRSSGRQVKKKVTEVAAD
DDDDTSCEKKYRKCEKAGCTATCPVCFSSAAERCAKNGYTSRWYHLSCGEHFCNECFDHY
YRSHKDGYEKYAAWKRIWTSNGKCEPSPKAFMADQQLPYWVQCTKPDCGKWRQLTKEIQL
TSQMAQAYRCGTKPNATVKTEGSDQCSQPEDLRVAEVSNQWWYSMLILPPFLKDSVAAPL
LSAYYPDCVGMSPSCTSTNRDPREASPQKAEQCKAAAGVFVPEMNQYFQPFYQPNECGKA
LCVRPDVMELDELYEFPEYSRDPTMYLALRNLILALWYSNCKEALTPQKCTHHIIVRGLV
RIRCVQEAERILYFMTRKGLINTGALSVSPDHHLLPKDYHNKSVIIVGAGPSGLAAARQL
HNFGIKVIVLEAKDRIGGRVWDDKSFKGVTVGRGAQIVNGCINNPIALMCEQLGIQMHKL
GERCDLIQESGRITDPTIDKRMDFHFNAILDVVSEWRKDKTQLQDVPLGEKIQEIYKAFI
QESGIQFNELEEQVLQFHLSNLEYACGSNLNQVSARSWDHNEFFAQFAGDHTLLTPGYSV
IIEKLAEGLDIRLKFPVRTIDYSGEEVQVTTMDGTVWTAQKVLVTIPLSLLQKGAIQFNP
PLPERKIKAINSLGAGIIEKIALEFPYRFWDNKIQGADFFGHVPPSSNKRGLFAVFYDMD
PQGKYSVLMSVITGEAVASIKNLDDKQVLQQCMATLRELFKEQEIPDPVNFFVTRWNTEP
WIQMAYSFVKTGGSGEAYDILAEDIQGTLFFAGEATNRHFPQTVTGAYLSGVREASKIAA
F
Download sequence
Identical sequences F6X020
ENSMODP00000014104 ENSMODP00000014104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]