SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014111 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000014111
Domain Number - Region: 95-140
Classification Level Classification E-value
Superfamily UBA-like 0.00102
Family CUE domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014111   Gene: ENSMODG00000011276   Transcript: ENSMODT00000014370
Sequence length 242
Comment pep:known_by_projection chromosome:BROADO5:1:109640916:109646369:1 gene:ENSMODG00000011276 transcript:ENSMODT00000014370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLGFTGMGSEWRTECLPDPWPHFLLSGTVCDMMFDVSSQLSDARNKENVCPESQEDNA
PASPELLQSLEEGTQEIRKSQAHTSAPLLGGGKKTETDELQAGIQLLLEMFPSCTLGRAQ
RALAMARGDLEEAVQIMVEEKVEPQALGNKMGMDLGQSIGSPKKEELKSFILQKYMMVDS
EEDQKTHRPVAPKEAPKKLIRYIDNQVVSTKGERYKDIRKPEPEGMKSTYISLKPARKYK
FH
Download sequence
Identical sequences F6WZS5
ENSMODP00000014111 ENSMODP00000014111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]