SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014112 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014112
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 9.55e-71
Family A middle domain of Talin 1 0.000000296
Further Details:      
 
Domain Number 2 Region: 756-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.45e-53
Family I/LWEQ domain 0.0000022
Further Details:      
 
Domain Number 3 Region: 661-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.06e-52
Family I/LWEQ domain 0.00000515
Further Details:      
 
Domain Number 4 Region: 2296-2486
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.06e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 5 Region: 1840-1974
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.96e-46
Family VBS domain 0.00000743
Further Details:      
 
Domain Number 6 Region: 1227-1363
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.49e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-32
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1076-1209
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.02e-29
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 8.88e-25
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1471-1557
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000157
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 2006-2133
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000154
Family VBS domain 0.021
Further Details:      
 
Domain Number 12 Region: 1698-1816
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000188
Family VBS domain 0.063
Further Details:      
 
Domain Number 13 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000507
Family Ubiquitin-related 0.062
Further Details:      
 
Domain Number 14 Region: 946-1044
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000029
Family I/LWEQ domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014112
Domain Number - Region: 1586-1661
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000377
Family VBS domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014112   Gene: ENSMODG00000011273   Transcript: ENSMODT00000014371
Sequence length 2542
Comment pep:known_by_projection chromosome:BROADO5:1:147739187:148002437:1 gene:ENSMODG00000011273 transcript:ENSMODT00000014371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEIIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNIGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQADLSEVDNLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDDVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTLSSPVCQEQLIEAGKLVDRSVENCVRACQDATDDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAHQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVASAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTNDPVAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPLFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDHIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRTKC
RIATVPLIEAVENLTAFASNPEFVSIPAQISSEGSRAQEPILVSAKTMLESSSFLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQNLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGMVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAITAQEMMTKSVTNPEELGGLASQMTSDYGHLALQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARSVTEKVSLVLSALQAGNKGTQACI
TAASAVSGIIADLDTTIMFATAGTLNAENNETFADHRENILKTAKALVEDTKLLVSGAAS
TQDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLIGATK
GAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYIKQELTV
FQSKEIPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASYHADVAEDVRARALRYGTECTLGYLDLLEHVLVILQKPTPDLKHQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences F6WZR8
ENSMODP00000014112 ENSMODP00000014112 XP_001365719.1.35504 XP_007479589.1.35504 XP_007479590.1.35504 XP_016287181.1.35504 XP_016287191.1.35504 XP_016287195.1.35504 XP_016287197.1.35504 XP_016287202.1.35504 XP_016287203.1.35504 XP_016287204.1.35504 XP_016287206.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]