SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014208 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014208
Domain Number 1 Region: 3-178
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.33e-36
Family Canonical RBD 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014208   Gene: ENSMODG00000011362   Transcript: ENSMODT00000014471
Sequence length 266
Comment pep:known_by_projection chromosome:BROADO5:1:275452521:275456281:1 gene:ENSMODG00000011362 transcript:ENSMODT00000014471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGK
ELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVS
WQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYSDLKNAIEKLSGKEINGRKIKLIEGS
KRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSHSKSRSVSRSPMPEKSQKRGS
SSRSKSPASVDRQRSRSRSRSVDSGN
Download sequence
Identical sequences F6T5A0 G3VJA0
XP_003756430.1.9362 XP_007473175.1.35504 XP_020860387.1.61212 XP_020860388.1.61212 ENSMODP00000014208 ENSSHAP00000003255 ENSMODP00000014208 13616.ENSMODP00000014208 ENSSHAP00000003255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]