SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014333 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014333
Domain Number 1 Region: 1205-1280
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000105
Family Canonical RBD 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014333   Gene: ENSMODG00000011467   Transcript: ENSMODT00000014599
Sequence length 1341
Comment pep:known_by_projection chromosome:BROADO5:1:110002339:110209595:-1 gene:ENSMODG00000011467 transcript:ENSMODT00000014599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLSDSSWDLPPSPFLEASSPKIPGWRTPRSWPRWGQLSPLQRSDGEEEEDARLSRDRVI
AVDPSIDNTEDFPMHLACPEEEEEEEAAPVGEESISSLSELVRAMHPYCLPSLSVCLDSP
GEEPEEQAEELMLAEGGMVLEILGQGSMAGEALEIPVVLRHLPPSSQPIEDLDSDLTQQL
LECDMEAEVPTRVGQSFQKEPTAPGKLEDGREKELTCSALPQEEVIPASVNSPKGPSADV
SSDAQKGQRGHRNRRKKSEVQLLPDRDKDRTCVQKLRKSRSQSIPDSQSSEQPLGVYRVA
QSAGGRRKLRTTVVEPKIVSSLGNPDFTEPGSTPQSALVKEEPLTLCPSNGKMSLSSANG
DHSQTPEPSFEVTSSQSERISSPSKTEHSANTVPQEAKPRPLSLSEYWQRRQQRQTGDQV
PEPQTPTGKWPSIPVTPTELAEIPCLIVPSKTAEQPTAPGVARQRTAQPPGPKPCSVASP
ETDLPLPAKHKSLVRQSVPPTMPIPPTVPPVVPMSPAVPPTVTLPLTMPRPPALPPTMPP
MVQLPSSGQVMPDLLRPPLPPPRLPRPPDSYAQFAPVPSWPRYPSVPPSVNYPCLPPPVS
GTPNAYPGPSTPAVPWVLPPAPVTAYGSDHSYGPMGWGPGPQPPYWPAVPPTPLPPPPPP
PPPPPPPPLVKSIPLPSQVPDSFSTGIPESVPASSAVSVIPPPSLVPTSQEGPQAALSRA
EGKQGPAPQQSLRTLSPRSKPKLATPGSPDARKKGAPVEDPVVQKGQPLPEGPAPQKAQP
EAKESEHSESPSVPADSAVSVPKQCQVTKMTPVHPSRLRRLSFLTPPHSQGSEDVVQAFI
SEIGIEASDLSSLLEQFEKSEVKKECIPLGPADTLALGNSGRVDNSQEKRPLDRLQAPEL
ANVAGLTPPATPPHQLWKPLAAVSLLAKPGSPDSPTQDRVLKPVGNIDAQRPAAARLRGR
VPGPSPVHVGSGDHDYCILSPTVTTGPELGSRWNVKRHQDITIKPILSLGPSAALPACPA
MCQKQQLDHRTSEELEATPPAPTSAPAQQSSVLLSPEASPGRNDDTRTHPGPLAKQPVHC
YQKACAPSSPPVRGWAGRSSRSCSNGASEASSSSSSSRSRSRSHSHSRSRSRSRSISPPP
KRWRRAWRSSSSSSSSSSSSSSSSSSSSSSSSSSSSRSQSRSPSPRRRSNRRRRYDYYDS
QDHYQRQKILQKERAIEERRVVFIGKIPGCMTRSELKHRFSVFGEIEECTIHFRFEGDNY
GFVTYRYAEEAFAAIESGHKLRRAGEQPFDLCFGGRRQFCKRNYADLDSNWEEFDPAPVK
SKFDSVDFDTLLKQAQKNLRR
Download sequence
Identical sequences F6W0B1
ENSMODP00000014333 ENSMODP00000014333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]