SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014541 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014541
Domain Number 1 Region: 34-72,126-473
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 6.19e-116
Family TRM1-like 0.0000356
Further Details:      
 
Domain Number 2 Region: 568-597
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000487
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014541   Gene: ENSMODG00000011619   Transcript: ENSMODT00000014809
Sequence length 610
Comment pep:known_by_projection chromosome:BROADO5:3:447244679:447250790:1 gene:ENSMODG00000011619 transcript:ENSMODT00000014809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTKASTQGPPTADIENGACGEQPQPEAELGETVISEGAVRIVFPNSNEVFYNPVQEFN
RDLTCAVITEFARMQLLSKGIQIEVPGEEKLQKVVVNLAESEEGSMEPCPRDQPQTAAVG
NVCEEGLRVLEGLAASGLRSIRFAKEVPGLQVVIANDASARAVDLIRCNVQLNNISHLVQ
PNLADARLLMYEHQRGSRRFDVIDLDPYGSPAIFLDAAVQAVSEGGLLCVTCTDMAVMAG
NSSETCYSKYGAMSIKSKACHEMALRIVLHSLDLRANCYQRYIVPLLSISADFYIRVFVR
VYTGQAKVKASASKQGFVFQCVGCGSFHLQRLGKAVNSGGRDKFSAATGPPVGSECEHCG
QRHQLGGPLWAEPIHDLDFVGQVLAAVSRNPGRFRTSARIRGVLSMVTEELPDVPLYYTL
DQLSSTIRCNTPRLLQLRSALLHAGFRVSLSHACKNAVKTDAPPSVLWDIMRCWEKENPV
KRERLSETSPAFRILQVEPRLQANFSIRDDANPSSRQQGLQRFQANPEANWGPKARARSG
GKATLELAEKRQQLQNKRKEPNRDQGMEKLKAFPCKKFKKGTCLMGNGCWYSHSPEEPQG
QPEPSPVPLP
Download sequence
Identical sequences F6UGF2
ENSMODP00000014541 ENSMODP00000014541 XP_007489184.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]