SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014599 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014599
Domain Number 1 Region: 114-331
Classification Level Classification E-value
Superfamily DNase I-like 3.01e-36
Family DNase I-like 0.071
Further Details:      
 
Domain Number 2 Region: 16-56
Classification Level Classification E-value
Superfamily UBA-like 0.0000000536
Family TAP-C domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014599   Gene: ENSMODG00000011653   Transcript: ENSMODT00000014867
Sequence length 355
Comment pep:known_by_projection chromosome:BROADO5:3:313987033:314010712:1 gene:ENSMODG00000011653 transcript:ENSMODT00000014867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVDGTVAAPEERVVEERQRLCAEFAAITGRGCDVAQCYLAENDWQMERALNSYFEAAVD
LGALDSRTPTPPTPPLAPTPAEAVCVDLTNEPTIDITNTDVNIENCVQKEDDSTFSLITW
NIDGLDINNLQARARSVCEYLALYTPDVVFLQEVIPPYYDYLKKRATSYRIISGNEDGYF
TVVMLKKSRVKLMSHEITPFPATQMMRNLLCVHVSVCGNELCLMSSHLESTRNHSRERMN
QLKIVLKKMQEIPESVTVIFGGDTNLRDHEVSKVGGLPDKILDVWEFLGKPEHCRYTWDT
QANTNLAIEASCKLRFDRIFFRPAAARWQSRESTNSGRCEFKSNLRYFQLCDPGC
Download sequence
Identical sequences F6TIJ5
ENSMODP00000040615 ENSMODP00000014599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]