SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014693 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014693
Domain Number 1 Region: 899-928
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000513
Family A20-like zinc finger 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014693
Domain Number - Region: 26-63
Classification Level Classification E-value
Superfamily UBA-like 0.000383
Family TAP-C domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014693   Gene: ENSMODG00000011729   Transcript: ENSMODT00000014964
Sequence length 933
Comment pep:known_by_projection chromosome:BROADO5:1:143100076:143425859:-1 gene:ENSMODG00000011729 transcript:ENSMODT00000014964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSLLLNPTSAECWAALLHDHMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAAL
SDYEQLRQVHTANLPQVFNEGKYYKQPEREPSQQVNKVERPCLQRQDDIAQEKRLSRGIS
HASSAIVSLARSHVANECSNEQFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVA
LEQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWGFHDRDLVLRKALYTMMRS
GAEREALKRRWRWQQTQQNKESGLVYTEEEWEREWNELLKLASSEPRTHFSKNGGTGGGV
DNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPN
RCHCSPLVLAYDQAHFSALVSMEQKDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGK
DDNDNARLANLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLAD
SMDSDRDSICSNSNSNNGKNGKEKEKDKQRKEKDKNRTDSVANKLGSLSKTLGIKLKKNM
GGLGGLVHGKMGRANSGNGKNGDGTDKVKEKKSKSRKGSKEESGQSASTSPSEKNTPSPT
DKASVSPVEKNTKTLSDKQSDPWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQF
HEEMIGYYLTSAQERFNAEQEQKRKEAEKKASLSGSSCRKLEQEAFSKEKLESSPQDRAS
PVLPQSHTTQLVLKFKDRTSPTPGSFSSPSNSAKRNGPTPVSAHYSHTPPVQRQSVIHLH
DVNSKPSSFQDDTYKPVVGTLKTCATYPQQNRSLSSQSYSPARIAGIRTVNTVESLTYAL
PTEHKSQTYTNGFNTGDIRDCLEYADEEAPQTWLNNDKNRGRSTVCPIYSIQQNRCKKEN
CSFYGRPETENYCSYCYKEELKRRERETKGHRH
Download sequence
Identical sequences F7FSS6
XP_007479562.1.35504 XP_007479563.1.35504 XP_007479564.1.35504 XP_007479565.1.35504 ENSMODP00000014693 ENSMODP00000014693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]