SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014811 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014811
Domain Number 1 Region: 565-1036
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-134
Family Ras GEF 0.000000000000303
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 5.07e-52
Family TBP-associated factors, TAFs 0.00000038
Further Details:      
 
Domain Number 3 Region: 207-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-39
Family DBL homology domain (DH-domain) 0.00000011
Further Details:      
 
Domain Number 4 Region: 416-572
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-37
Family Pleckstrin-homology domain (PH domain) 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014811   Gene: ENSMODG00000011821   Transcript: ENSMODT00000015083
Sequence length 1328
Comment pep:known_by_projection chromosome:BROADO5:1:277429705:277561165:1 gene:ENSMODG00000011821 transcript:ENSMODT00000015083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPQQPYDFSSEENHPKWRGLFVPALRKVQQQVHPNLSAKEDSLYYIEELILQLLSKLC
IAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRTPLLLPVDKIHPLLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPFSSGELNYYDLVRTEIAEERQYLRELNLIIKVFREAFLSNKKLFASSDI
EGIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPQFHERFNTLMAKPAVSLHFQSIADGFKEAVRYVLPRLMLVPVYHCSHYFELLEQLQE
CSEEQEDRECLKQAITALLNFRCSMERICNKHSPRRRPADPVCRFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLMRIGAKHERHIFLFDGLMISCKTNHGQSRIPG
YSNAEYRLKEKFIMRKVQICDKDDTCEYKHAFELISKDENSILFAAKSIEEKNNWMAALI
SLQYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNSQSGIPIIKGG
TVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLKLLIERFEIPEPEPTEADKLAVE
KGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISTVKGK
TMKKWVESIVKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQYESFDLMTLHPIEI
ARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAEN
FEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILDEA
VELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKQGKELINFSKRRKV
AEITGEIQQYQNQPYCLRIESEIRRFFENLNPMGNTSEKEFTDYLFNKSQEIEPRNCKQP
PRFPRKTTFSLKSPGIRPHAGRHGSTSGTLRGHPTPLEREPCKISFSRINEAEHESTASA
PTSPNTPSTPPVSASSDLSVFLDIDLNSSYGSNSIFAPVVLPHSKSFFSSCGSLHKLSEE
PLVPPPLPPRKKFDQDVSTSKGNLKYDDDPPAIPPRQPPPPKIKPRVPAYGGPFDGPLPS
PPPPPPRDPLPETPPPVPLRPPEHFINYPFNLQPPPMGHAHRDPEWFREASTCPNSPNTP
PSTPSPRVPRRCVLSSSQNNLAHSQAPPIPPRQNSSPHLPKLPPKTYKRDLCQPPMYRLS
LLEHAETP
Download sequence
Identical sequences F6YCI3
ENSMODP00000014811 ENSMODP00000014811 XP_001379052.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]